ASB4:Ankyrin repeat and SOCS box protein 4

Gene Name
Ankyrin repeat and SOCS box protein 4
Protein ID
Q9Y574
Chromosome ID
7
HPP Status
2
Protein Name
Ankyrin repeat and SOCS box protein 4
Synonyms

ankyrin repeat and SOCS box protein 4

ankyrin repeat and SOCS box-containing 4

ankyrin repeat and SOCS box containing 4

ASB-4


[Reference: http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4 ]
Chromosomal Position
7q21.3 | Start:95478444 End:95478444
Sequence
Q9Y574.fasta
Description

Entrez Gene Summary for ASB4
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but some of the full length sequences are not known. (provided by RefSeq, Jul 2008)

UniProtKB Summary for ASB4
Function: Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes differentiation and maturation of the vascular lineage by an oxygen-dependent mechanism (By similarity)

[Reference: http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4 ]
External IDs
Hgnc ID: 16009 EntrezGene ID: 51666 Ensembl ID: ENSG00000005981
[Reference: http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4 ]
Reference Source
http://www.nextprot.org

Gene Reference Into Function (GeneRIF)


PubMed IDGeneRIF TextLast Update
15929745Based on its differential expression, neuroanatomical distribution and colocalisation, we hypothesise that rat Asb-4 is a gene involved in energy homeostasis.2010-01-21
Reference
http://www.ncbi.nlm.nih.gov/gene/about-generif
ftp://ftp.ncbi.nih.gov/gene/GeneRIF/

OMICSDI Browser



Relevant citations within the PubMed literature

         

Putative/known Functions


Generic function

Function Description

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes differentiation and maturation of the vascular lineage by an oxygen-dependent mechanism.

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.


Reference
http://www.uniprot.org/uniprot/Q9Y574
Contributed By
Chromosome 7 Research Group Australia

Biological function

Function Description

intracellular signal transduction, positive regulation of vasculogenesis, protein autoubiquitination

Reference
http://www.uniprot.org/uniprot/Q9Y574
Contributed By
Chromosome 7 Research Group Australia

Molecular function

Function Description

ubiquitin protein ligase activity, ubiquitin protein ligase binding, ubiquitin-protein transferase activity

Reference
http://www.uniprot.org/uniprot/Q9Y574
Contributed By
Chromosome 7 Research Group Australia

Localisation


Subcellular

Localization Description

Cul2-RING ubiquitin ligase complex, Cul5-RING ubiquitin ligase complex, cytoplasm, nucleus

Reference
http://www.uniprot.org/uniprot/Q9Y574#subcellular_location
Contributed By
Chromosome 7 Research Group Australia

Organ

Localization Description

This gene is overexpressed in Liver, secretome and Heart.

Reference
http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4&keywords=ASB4#localization
Contributed By
Chromosome 7 Research Group Australia

Homologues, Orthologues, Paralogues and Family


Orthologues

Orthologs

cow (Bos Taurus), dog (Canis familiaris), mouse (Mus musculus), chimpanzee (Pan troglodytes), rat (Rattus norvegicus), oppossum (Monodelphis domestica), chicken (Gallus gallus), lizard (Anolis carolinensis), tropical clawed frog (Silurana tropicalis), zebrafish (Danio rerio)

Reference
http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4&keywords=ASB4#orthologs
Contributed By
Chromosome 7 Research Group Australia

Paralogues

Paralogs

ASB10, ASB18, ASB16

Reference
http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4&keywords=ASB4#orthologs
Contributed By
Chromosome 7 Research Group Australia

Family

Domain

6 Ankyrin repeat, 1 SOCS box,

Identified Families

Ankyrin SOCS box (ASB) family

Reference
http://www.uniprot.org/uniprot/Q9Y574#family_and_domains
Contributed By
Chromosome 7 Research Group Australia

Sequence Similarity and Functional Annotation


Sequence Similarity

Db NameQuery UniSubject UniSequence LengthAlignment LengthIdentityCoverageMismatchesGap OpeningsQuery StartQuery EndSubject StartSubject EndEvalueBit Score
Reviewed non-human mammalian with experimental evidenceASB4_HUMANASB4_MOUSE42642692.49100320142614260806
Reference
Islam MT, Garg G, Hancock WS, Risk BA, Baker MS, Ranganathan S (2014) Protannotator: A Semiautomated Pipeline for Chromosome-Wise Functional Annotation of the "Missing" Human Proteome. J Proteome Res. 13, 76-83.

InterProScan Annotation

Uniprot IDInterpro IDGo IDTypeNameCategoryDescription
ASB4_HUMANIPR001496GO:0035556DomainSOCS protein, C-terminalBiological Processintracellular signal transduction
ASB4_HUMANIPR002110GO:0005515RepeatAnkyrin repeatMolecular Functionprotein binding
Reference
Islam MT, Garg G, Hancock WS, Risk BA, Baker MS, Ranganathan S (2014) Protannotator: A Semiautomated Pipeline for Chromosome-Wise Functional Annotation of the "Missing" Human Proteome. J Proteome Res. 13, 76-83.

Post Translational Modifications


Showing 1-3 of 3 items.

Post Translational Modifications

Ptm NamePtm SiteEvidence
PhosphorylationS11 - p<p>Methods used to characterize site in vivo: mass spectrometry </p><p>Relevant cell line - cell type - tissue: NCI-H3255 (pulmonary) </p>
PhosphorylationT109<p>Methods used to characterize site in vivo: mass spectrometry</p><p>Disease tissue studied: brain cancer, glioblastoma, glioma </p><p>Relevant cell line - cell type - tissue: M059K (glial) </p>
PhosphorylationY426 - p<p>Methods used to characterize site in vivo: mass spectrometry </p><p>Disease tissue studied: bladder cancer, lung cancer, non-small cell lung cancer, ovarian cancer </p><p>Relevant cell line - cell type - tissue: lung , PA-1 (ovarian), PC9 (pulmonary), SW780 (bladder cell) </p>

Protein Protein Interactions


Database Name

UniProt

Database Link

http://www.uniprot.org/uniprot/Q9Y574#interaction ">http://www.uniprot.org/uniprot/Q9Y574#interaction

Interaction

-

Interacting Partner

Subunit structure interacts with HIF1AN. Component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex formed of CUL2 or CUL5, Elongin BC (TCEB1 and TCEB2), RBX1 and ASB4.

Reference
http://www.uniprot.org/uniprot/Q9Y574#interaction
Contributed By
Chromosome 7 Research Group Australia
Database Name

BioGRID

Database Link

http://thebiogrid.org/119669/summary/homo-sapiens/asb4.html ">http://thebiogrid.org/119669/summary/homo-sapiens/...

Interaction

27 total unique interactors

Interacting Partner

HIF1AN, CUL5, ASB7, ID2, CUL4A, DNAJB5, RNF7, RPS27L, HSPD1, HSPB1, TUBB2A, RIT1, UBE2D1, TCEB2, DDB1, TUBB4A, DNAJB4, HSPB8, TFRC, GPS1, HSP90AA1, TUBB8, TUBB3, STUB1, FARSA, CUL2, GPS1

Reference
http://thebiogrid.org/119669/summary/homo-sapiens/asb4.html
Contributed By
Chromosome 7 Research Group Australia
Database Name

STRING

Database Link

http://string-db.org/cgi/network.pl?taskId=xGn717LC5EdY ">http://string-db.org/cgi/network.pl?taskId=xGn717L...

Interaction

Predicted

Interacting Partner

Predicted functional partners: CUL5, CUL2, RNF7, TCEB2, GPS1, RBX1, ZER1, COMMD1, IRS4, INS

Reference
http://string-db.org/cgi/network.pl?taskId=xGn717LC5EdY
Contributed By
Chromosome 7 Research Group Australia
Database Name

-

Database Link

http://www.ncbi.nlm.nih.gov/pubmed/?term=21955513 ">http://www.ncbi.nlm.nih.gov/pubmed/?term=21955513

Interaction

Ankyrin repeat and SOCS box containing protein 4 (Asb-4) colocalizes with insulin receptor substrate 4 (IRS4) in the hypothalamic neurons and mediates IRS4 degradation.

Evidence: in situ hybridisation

Interacting Partner

-

Reference
Li, Ji-Yao, et al. "Ankyrin repeat and SOCS box containing protein 4 (Asb-4) colocalizes with insulin receptor substrate 4 (IRS4) in the hypothalamic neurons and mediates IRS4 degradation." BMC neuroscience 12.1 (2011): 1.
Pubmed ID: 21955513
Contributed By
Chromosome 7 Research Group Australia

Best Available Mass Spectra without FDR




Showing 1-3 of 3 items.

PRIDE

Peptide SequenceScoresPride IDSpectrum IDAnnotation
MDGTTAPVTKSGAAK37.41,Mascot:score;0.00651938913459956,Mascot:expectation;PXD003271_59836_361_Q9Y574_MDGTTAPVTKSGAAKPXD003271;MR306.mgf;index=2440
VIQACHSCPKAIEVVVNAYEHIRWNTK11.05,Spectrum Mill peptide score;PRD000053_8862_2133_Q9Y574_VIQACHSCPKAIEVVVNAYEHIRWNTKPRD000053;PRIDE_Exp_Complete_Ac_8862.xml;spectrum=2133
VIQACHSCPKAIEVVVNAYEHIRWNTK11.05,Spectrum Mill peptide score;PRD000053_8869_2133_Q9Y574_VIQACHSCPKAIEVVVNAYEHIRWNTKPRD000053;PRIDE_Exp_Complete_Ac_8869.xml;spectrum=2133
Evidence File
/mnt/mpp/ms_data/Q9Y574_pridedb.txt
Reference
Vizcaino JA, et al. 2016 update of the PRIDE database and related tools. Nucleic Acids Res. 2016 Jan 1;44(D1):D447-D456.
https://www.ebi.ac.uk/pride/archive/ ">PRIDE Archive


Showing 1-3 of 3 items.

Proteomics DB

Peptide SequenceSearch EngineScoreThreshold ScoreIdentification IDExperiment IDAnnotation
DDDFKSPLHKMaxquant149.9401319632683-1
RNFLEALKMaxquant120.8701323454193-1
AIPLLSLPLSLKMascot61.4414650245061-1
Evidence File
/mnt/mpp/ms_data/Q9Y574_protdb.txt
Reference
Wilhelm, M et al. (2014) Mass-spectrometry-based draft of the human proteome. Nature. 509:582-7.
https://www.proteomicsdb.org/ ">Proteomics DB

Other Evidence


Evidence Type

Other

Evidence Info

'Li et al. (2011) stated that Asb4 is downregulated by fasting in rats and in genetically obese Zucker rats.Mouse Asb4 interacted with endogenous IRS4 and cotransfected mouse Irs4 in HEK293 cells, and Asb4 and Irs4 coimmunoprecipitated from rat hypothalamic extracts. Expression of mouse Asb4 in HEK293 cells reduced the level of endogenous and cotransfected IRS4 in a dose-dependent manner. Asb4 increased ubiquitination of Irs4 following expression in Chinese hamster ovary cells. Deletion of the SOCS box in Asb4 abrogated binding of Asb4 to Irs4 and Asb4-dependent Irs4 ubiquitination.'

Reference
Li, Ji-Yao, et al. "Ankyrin repeat and SOCS box containing protein 4 (Asb-4) colocalizes with insulin receptor substrate 4 (IRS4) in the hypothalamic neurons and mediates IRS4 degradation." BMC neuroscience 12.1 (2011): 1.
Pubmed ID: 21955513
http://www.omim.org/entry/605761?search=ASB4&highlight=asb4
Contributed By
Chromosome 7 Research Group Australia
Evidence Type

Other

Evidence Info

Hydroxylation at Asn-246 by HIF1AN may provide an oxygen-dependent regulation mechanism for the function of ASB4 in promoting vascular differentiation.

Reference
http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASB4
Contributed By
Chromosome 7 Research Group Australia
Evidence Type

Other

Evidence Info

Thesis on the protein:

Investigating the role of ankyrin repeat and SOCS box protein 4 (ASB4) during vascular development by Ferguson, James Edward, Iii, Ph.D., THE UNIVERSITY OF NORTH CAROLINA AT CHAPEL HILL, 2007, 98 pages; 3272526

Reference
https://books.google.com.au/books?id=6BddG04jnpMC&pg=PA63&lpg=PA63&dq=ASB4 protein&source=bl&ots=Utqxkbq1sJ&sig=iTqtywgQIIAn88H2uqPNkR4qTuc&hl=en&sa=X&ved=0ahUKEwj38LC6j6jJAhWjPKYKHQSPAHEQ6AEIRDAH#v=onepage&q=ASB4 protein&f=false
Contributed By
Chromosome 7 Research Group Australia